Protein Info for DvMF_2680 in Desulfovibrio vulgaris Miyazaki F

Annotation: 3,4-dihydroxy-2-butanone 4-phosphate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 13 to 207 (195 residues), 244.6 bits, see alignment E=3.4e-77 PF00926: DHBP_synthase" amino acids 16 to 206 (191 residues), 272.9 bits, see alignment E=6.2e-86

Best Hits

Swiss-Prot: 69% identical to RIBB_SHESW: 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB) from Shewanella sp. (strain W3-18-1)

KEGG orthology group: K02858, 3,4-dihydroxy 2-butanone 4-phosphate synthase [EC: 4.1.99.12] (inferred from 100% identity to dvm:DvMF_2680)

MetaCyc: 66% identical to 3,4-dihydroxy-2-butanone-4-phosphate synthase (Escherichia coli K-12 substr. MG1655)
3,4-dihydroxy-2-butanone-4-phosphate synthase. [EC: 4.1.99.12]

Predicted SEED Role

"3,4-dihydroxy-2-butanone 4-phosphate synthase (EC 4.1.99.12)" (EC 4.1.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.99.12

Use Curated BLAST to search for 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIV8 at UniProt or InterPro

Protein Sequence (217 amino acids)

>DvMF_2680 3,4-dihydroxy-2-butanone 4-phosphate synthase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSHASQPCQAPLATVEQALDALRAGRGILVVDDEDRENEGDMIFAAETLTEAQMALLIRE
GSGIVCLCLTGAHADALDLPPMVACNTSRTGTAFTVTIEAAEGVTTGVSAADRVATVKAA
AAPGARPEHLRRPGHVFPLRARPGGVLERRGHTEATVDLMRLAGLSPCGVLCELTNPDGT
MARLPEVLAFGARQDMPVLTVQALARWRARHDADTRC