Protein Info for DvMF_2651 in Desulfovibrio vulgaris Miyazaki F

Annotation: dihydrouridine synthase DuS (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF01207: Dus" amino acids 51 to 293 (243 residues), 195.3 bits, see alignment E=1.4e-61 PF13378: MR_MLE_C" amino acids 118 to 261 (144 residues), 32.4 bits, see alignment E=8.1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2651)

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIS9 at UniProt or InterPro

Protein Sequence (383 amino acids)

>DvMF_2651 dihydrouridine synthase DuS (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPLPGALPGPPPGTVLETASDTVPAGDAALAARLRQPLTVGGRTVPGRLWLAPMAGLGHA
AFREVVEDYGGCGLLFTGMCNARAVPTERPEKSEAFSWRAGEPPRLVCQLFGAEPEHMAE
GARRVQAEGFFGVDLNMGCSVSAIIKRGCGADLLRDPERAVRMVAAVRRAVDIPVFVKFR
TGWSPDPQPAVDLARRFEDAGADCLVFHPRVAPDRRTQPPRRAHIGLVKAAVSIPVMGNG
DVFTPEDCANLLDDTGCDGVSLGRIAVARPWVFAAWTGMVDDDPDRNPAPWREAPLALLD
ALARRHGPARAVRMFGKFLVYITGNFTYGNGLRGRLLRVTGRTPASFGADDPGGLRALQD
ALRAELDPLPAVLRRPSALLFGM