Protein Info for DvMF_2633 in Desulfovibrio vulgaris Miyazaki F

Annotation: Aldehyde Dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 4 to 427 (424 residues), 199.1 bits, E=5.4e-63

Best Hits

Swiss-Prot: 32% identical to AL3A2_RAT: Fatty aldehyde dehydrogenase (Aldh3a2) from Rattus norvegicus

KEGG orthology group: K00128, aldehyde dehydrogenase (NAD+) [EC: 1.2.1.3] (inferred from 100% identity to dvm:DvMF_2633)

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• hypotaurine degradation (3/3 steps found)
• phytol degradation (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• putrescine degradation IV (2/3 steps found)
• ethylene glycol degradation (1/2 steps found)
• putrescine degradation I (1/2 steps found)
• putrescine degradation V (1/2 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• D-arabinose degradation II (2/4 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• superpathway of glycol metabolism and degradation (4/7 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• octane oxidation (2/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)
• putrescine degradation III (1/4 steps found)
• serotonin degradation (3/7 steps found)
• dopamine degradation (1/5 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• superpathway of ornithine degradation (2/8 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• aromatic biogenic amine degradation (bacteria) (1/8 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (2/11 steps found)
• superpathway of L-arginine and L-ornithine degradation (3/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• superpathway of pentose and pentitol degradation (5/42 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.3

Sequence Analysis Tools

See B8DIR1 at UniProt or InterPro

Protein Sequence (460 amino acids)

>DvMF_2633 Aldehyde Dehydrogenase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MAALAARQKAFIASGAVLPSGARVDALRRLREGVQGYRDRLADAIRADYGRPEHPFLVRE
VVPVLHEIDWLIKAVPGFCGGRRVLPSLGQFKARSYVRRQPLGRVVAYAHWADPFRSLLV
PLADAIGAGNAVVLRPSAEAPATAEMVTRMVRQYFEPEHVAVVGGGAETDEALLATAPDF
VWYDGDARGARTIAVLAAPTLTPYAAITGGPSAALVHGDADMAMAARRIVWAKFLHAGQL
RAAPDVLLVQRTVLDRVLDALRTELERAFGPQPRTSADFGRMVSAAGFARQAERLAIGRA
LPFGPGDAANQPDRASLYVPPTLLTDVPDDSPVLREEGFGPVLVVRPYTRLDEATAFLAG
LPALTALYAFTTAHARGERLMENTRAGAVLINDAATHLANPRLPQGGVGETGHGAMAGPA
GLATFSAPRATAVGSNFFDIPLRFAPGSDLKLKVLKRLYK