Protein Info for DvMF_2625 in Desulfovibrio vulgaris Miyazaki F

Annotation: Phosphate butyryltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to PTB_CLOAB: Phosphate butyryltransferase (ptb) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: K00634, phosphate butyryltransferase [EC: 2.3.1.19] (inferred from 100% identity to dvm:DvMF_2625)

MetaCyc: 45% identical to phosphotransbutyrylase subunit (Clostridium acetobutylicum)
Phosphate butyryltransferase. [EC: 2.3.1.19]

Predicted SEED Role

"Phosphate butyryltransferase (EC 2.3.1.19)" (EC 2.3.1.19)

MetaCyc Pathways

superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
pyruvate fermentation to butanoate (3/7 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIQ3 at UniProt or InterPro

Protein Sequence (324 amino acids)

>DvMF_2625 Phosphate butyryltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTTEAKICQGPHTGGQGPSSLDELVARVAACGARPRIALAACAEAHALGALLDAMERGIA
QPLLVGDMDQTARIAAELGRDISGIAAVHAPDPREAVQCAVDMVRRGEADVLMKGLVNTD
VLLRRVLNRATGLPPKGVLSHVAVFELPASGGTTRLAMMTDAAVNIRPNLQRKLEIVHNA
VAVARALGIARPRVAMLAATEKVILPAMPATLDAQIVARMAEQGEFGEADVAGPMALDIA
LSPDAAARKGVDHPVAGCADILVAPDIESGNILYKSLTILARADMASTMAGSSAPLVVTS
RGDSERSKFCSIALAGYLALAARS