Protein Info for DvMF_2613 in Desulfovibrio vulgaris Miyazaki F

Name: nifH
Annotation: nitrogenase reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00142: Fer4_NifH" amino acids 2 to 273 (272 residues), 408.6 bits, see alignment E=2e-126 TIGR01287: nitrogenase iron protein" amino acids 2 to 274 (273 residues), 446.8 bits, see alignment E=1.4e-138 PF01656: CbiA" amino acids 5 to 226 (222 residues), 40.8 bits, see alignment E=3.1e-14

Best Hits

Swiss-Prot: 86% identical to NIFH_DESAD: Nitrogenase iron protein (nifH) from Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)

KEGG orthology group: K02588, nitrogenase iron protein NifH [EC: 1.18.6.1] (inferred from 100% identity to dvm:DvMF_2613)

MetaCyc: 72% identical to [MoFe]-nitrogenase complex nitrogenase reductase component monomer (Clostridium pasteurianum)
Nitrogenase. [EC: 1.18.6.1]

Predicted SEED Role

"Nitrogenase (molybdenum-iron) reductase and maturation protein NifH" in subsystem Nitrogen fixation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR74 at UniProt or InterPro

Protein Sequence (276 amino acids)

>DvMF_2613 nitrogenase reductase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRKVAIYGKGGIGKSTTTQNTVAGLAEALGRKVMVVGCDPKADSTRLLLGGLAQKSVLDT
LRDEGEDVELDDIRKPGYSTTLCVESGGPEPGVGCAGRGIITSINMLESLGAYEEDQKLD
YVFYDVLGDVVCGGFAMPIRDGKAEEIYIVCSGEMMAMYAANNICKGIMKYAESGAVRLG
GLICNSRNVDNEKEMIEELARKIGTQMIYFVPRDNQVQRAEIHRQTVIEFSPEHGQAQHY
RNLAKAIDENQMFVVPKPLQIAELEKLLMDYGLFEA