Protein Info for DvMF_2606 in Desulfovibrio vulgaris Miyazaki F

Annotation: large conductance mechanosensitive channel protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details PF01741: MscL" amino acids 1 to 126 (126 residues), 128 bits, see alignment E=1.4e-41 TIGR00220: large conductance mechanosensitive channel protein" amino acids 1 to 114 (114 residues), 105.5 bits, see alignment E=1.2e-34

Best Hits

Swiss-Prot: 100% identical to MSCL_DESVM: Large-conductance mechanosensitive channel (mscL) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 100% identity to dvm:DvMF_2606)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR67 at UniProt or InterPro

Protein Sequence (148 amino acids)

>DvMF_2606 large conductance mechanosensitive channel protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLKAFKEFAVKGNALDMAVGVILGASFGTIVKSLVDDLIMPPIGLVLGGVDFSNLFVTLR
DGAAPGPYASLAAAKQAGAVTLNVGVFANTVVSFTIVAFAVFLLVRGVNTLRERLEGPAA
PKQQACPFCFSKIDVRATRCPHCTATIG