Protein Info for DvMF_2594 in Desulfovibrio vulgaris Miyazaki F

Annotation: hmc operon protein 5 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 24 (1 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 174 to 201 (28 residues), see Phobius details

Best Hits

Swiss-Prot: 85% identical to HMC5_DESVH: Protein DVU_0532 (DVU_0532) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2594)

MetaCyc: 85% identical to Hmc complex E subunit (Desulfovibrio vulgaris)

Predicted SEED Role

"Protein DVU_0532 (HMC operon ORF 5)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR55 at UniProt or InterPro

Protein Sequence (226 amino acids)

>DvMF_2594 hmc operon protein 5 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MYAFLTGPMLWVALLVFFGGLAARVVWYVRGLSWQLDRVAYGPHLAHGLKGGIHSALKWM
LPFGTQSWREQPYFAVAFFLFHIGAVLVPLFLAGHNIILAERFGFSLPALPMGIADALTV
AAIIGLVMIALRRIALTEVRILTTAYDWFILAVSAAPFVTGFVARLHVANYDAWLLAHII
TGELLLIVAPFTKLSHIVLFFMSRGQLGMDYAIKRGGYSRGAAFPW