Protein Info for DvMF_2592 in Desulfovibrio vulgaris Miyazaki F

Annotation: two component transcriptional regulator, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF00072: Response_reg" amino acids 15 to 121 (107 residues), 71.2 bits, see alignment E=4.1e-24

Best Hits

Swiss-Prot: 70% identical to RRF1_DESVH: Protein rrf1 (rrf1) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2592)

Predicted SEED Role

"response regulator, rrf1 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR53 at UniProt or InterPro

Protein Sequence (128 amino acids)

>DvMF_2592 two component transcriptional regulator, Fis family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MANATQARNTQAKSILVVEDDPDIAAYLVSLFRTNGYRADAATEGPDAVEMARARRPDLV
TLDLEMPRQWGPRVYRELMDLPGGAHIPVVLVTGLGGLHLMVPNAVGTVDKPFDPDLMLG
IVRRALGE