Protein Info for DvMF_2588 in Desulfovibrio vulgaris Miyazaki F
Annotation: phosphatidylglycerophosphatase A (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 100% identity to dvm:DvMF_2588)Predicted SEED Role
"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)
MetaCyc Pathways
- cardiolipin biosynthesis II (3/3 steps found)
- phosphatidylglycerol biosynthesis I (5/6 steps found)
- phosphatidylglycerol biosynthesis II (5/6 steps found)
- superpathway of phospholipid biosynthesis III (E. coli) (9/12 steps found)
- cardiolipin biosynthesis I (2/3 steps found)
- cardiolipin biosynthesis III (2/3 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
- type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
- superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.3.27
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B8DR49 at UniProt or InterPro
Protein Sequence (174 amino acids)
>DvMF_2588 phosphatidylglycerophosphatase A (RefSeq) (Desulfovibrio vulgaris Miyazaki F) MHATHDNGPEGCIPPHGRHGLDRLALEVARVWYAGRSPVAPGTVGSAVAALLAQWLFLPL PLGWRVVVLLAVFFGGAWAAGRAARVLGRCDPGSVVIDEVAGQWMTMLPFATLSPLGVLA AFVLFRVFDILKPGPVGASESWLEGGPGIMIDDVVAGACAAAVLAVLLWLGLPG