Protein Info for DvMF_2564 in Desulfovibrio vulgaris Miyazaki F

Annotation: methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 839 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 334 to 357 (24 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 46 to 328 (283 residues), 85.7 bits, see alignment E=1.1e-27 PF17202: sCache_3_3" amino acids 121 to 217 (97 residues), 39.2 bits, see alignment E=2.3e-13 PF00672: HAMP" amino acids 355 to 406 (52 residues), 31.7 bits, see alignment 4.8e-11 PF00989: PAS" amino acids 415 to 520 (106 residues), 30.3 bits, see alignment E=1.1e-10 PF08448: PAS_4" amino acids 416 to 529 (114 residues), 32 bits, see alignment E=3.7e-11 TIGR00229: PAS domain S-box protein" amino acids 420 to 530 (111 residues), 24.2 bits, see alignment E=1.5e-09 PF00015: MCPsignal" amino acids 607 to 790 (184 residues), 130.9 bits, see alignment E=1.4e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2564)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR25 at UniProt or InterPro

Protein Sequence (839 amino acids)

>DvMF_2564 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MFSTLSFRTKLIAGSLVMVLVTMAAMLVTSLVDARRGYLAQGRASLRNVSQILMESARFQ
DTLNRNKIGSDLKLMQLQFGLAGFPIPEIFMEVEADLRDADTGQRVKATLPGFKLGSAYL
HQGTDLVDRIRELAGVGASVLQLHEGRLVRVSSSVADPSGSARWTFLGKEHPVTAAVLSG
NGFTGMLKVGGQWNLAAYAPVKGMDGSEILGAVEVARPLLTPEFAAAVVRHNVGGKGYSL
AFDGAGIILIHPDPAMVGRNVFDLPWGAALKQGDGAQGRNDPAARADTGGSRVLACAING
AEYEACADRYAPWDVIFVTMVSRDELMDGVGERLWRGAAIAAAVALPVAALVIWLMVRQL
MVPMQRLATLAQQVARGNFDYTFDYAADDTIGATVRAVQAMVGELRMRLGFSQGVLDGVV
VPCVVVDLANDITHVNAEALAVLRRGGAPAQWLGRQLGELVYGSAADAARPVLTRRSMER
RDRVAEDVVLDPQADGREVVLHMVATPIYDLDGELMGAISLWVDLTHERAQHARLDAQNA
VIAATAREAEDIARRVASSAHELAEQVAHSSEGAARQLARVDEVTAAMDRMNRTVVEVGR
RAALAVDMAASTMQVAEDGRDVVRASMDVMHKVHGQVERLQENVAELGREAEGIGQIMGV
ISDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEKTMSATGQVGERIRAIQRA
TRGFVDSTATVAGAVRESDALATRSGGALDDILARIGDSGGEVRAIAAMAEAQARGGADV
ERAVAEVDAIARETAQGMAESAHAVTGLSRLAGELQRAMDGMACDGDGATHCDDEESLV