Protein Info for DvMF_2540 in Desulfovibrio vulgaris Miyazaki F

Annotation: response regulator receiver protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF00072: Response_reg" amino acids 12 to 131 (120 residues), 70.7 bits, see alignment E=5.8e-24

Best Hits

Swiss-Prot: 53% identical to RCP1_SYNY3: Response regulator rcp1 (rcp1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2540)

Predicted SEED Role

"Two-component system response regulator" in subsystem Streptococcal Mga Regulon or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DR01 at UniProt or InterPro

Protein Sequence (150 amino acids)

>DvMF_2540 response regulator receiver protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSGMHQARLIDILLVEDDPGDVRLTREALKGNRVSNRLFVVEDGEEAMAFLRREGQYADA
PRPDLVLLDLNLPRKNGREVLEEIKSTPDLRSIPVVVLTTSRQERDILHAYDLSANCYIT
KPVGWEQFVEVVGQIEHFWMAIVTLPVKGD