Protein Info for DvMF_2513 in Desulfovibrio vulgaris Miyazaki F

Name: infB
Annotation: translation initiation factor IF-2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1079 PF04760: IF2_N" amino acids 4 to 50 (47 residues), 40.2 bits, see alignment (E = 9.4e-14) amino acids 503 to 553 (51 residues), 53.5 bits, see alignment 6.7e-18 TIGR00487: translation initiation factor IF-2" amino acids 496 to 1077 (582 residues), 854.7 bits, see alignment E=4.1e-261 TIGR00231: small GTP-binding protein domain" amino acids 581 to 736 (156 residues), 108.9 bits, see alignment E=2.2e-35 PF01926: MMR_HSR1" amino acids 583 to 688 (106 residues), 43.6 bits, see alignment E=1.2e-14 PF00009: GTP_EFTU" amino acids 583 to 738 (156 residues), 116.7 bits, see alignment E=4.1e-37 PF00071: Ras" amino acids 584 to 739 (156 residues), 25.8 bits, see alignment E=2.8e-09 PF00025: Arf" amino acids 585 to 738 (154 residues), 24.3 bits, see alignment E=8.1e-09 PF22042: EF-G_D2" amino acids 753 to 831 (79 residues), 95.8 bits, see alignment 5.3e-31 PF11987: IF-2" amino acids 853 to 969 (117 residues), 140.4 bits, see alignment E=9.8e-45 PF03144: GTP_EFTU_D2" amino acids 1000 to 1067 (68 residues), 32.8 bits, see alignment 3e-11

Best Hits

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 100% identity to dvm:DvMF_2513)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN12 at UniProt or InterPro

Protein Sequence (1079 amino acids)

>DvMF_2513 translation initiation factor IF-2 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTDDKTRVKDLSTELGVSTKDLLHTLRDLDIPAKSVMTTLTADEVSRVRERHQGQTAEAG
VDRKVVQPGVIVRRRRRDGEEGEAPVRRRADEGEAASGIADAEAPAAKAEAPVPPAADER
PARAARAEAPAAPEARPATPAARIIRRHDEPAPVAEAPAEPVQVAPVAPAAPVTPAPASA
DKPADVQVEAAPAVAAQQAEKPATPTARIIRPARPDASAMPDATPQPSILPPVAADAAPR
GEGVDGDEDDADGNRRRKKKRTPDAPGPQVRVISRPDPSAPAPRPYPQGDRTDRGDRPAY
GDRQGYQPRSGGPGGDRPSYGGDRQGYAPRPGGPGGPGGDRPGYAPRPGGPGGDRPGYAP
RPGGPGGDRPGYGPRPGGPGGPGGPGGDRPGGYRPGGPGGPRPGGPGGPGYGPRPGGPGG
PGGPGMGQPPAGGDEGQSKKKRLKGRRTVDFQPGADRTTRGREDDDFPRGGARRGKGRKG
RDMKVATATQPLKAAKRKIKVEEAIRVADMAHQMGLKSTEIIKVLFGLGVMATINQSLDI
ETATLVASEFGYEVEKVGFSEDDYLIPKEEDTPETLQHRPPVVTIMGHVDHGKTSLLDAI
RKTNVTMGEAGGITQHIGAYHVTTKKGEIVFLDTPGHEAFTAMRARGAQVTDIVVLVVAA
DDGVMEQTREAVNHSKAAGVPIMVAVNKMDKEGANPERVQRELAEMGLVSEAWGGDTVFS
HVSAKTRQGLDELLELLALQAEILELKANPDKPARGHIVEAKLDKGRGPVATVLIQEGTL
KQGDTFVCGVFSGRVRAMFNDQGKKVKEAGPAMPVEVQGFEGVPEAGEEFVCVTDEKLAR
RIAETRAVKQREKELARESKVTLETFLSRRVDDQEALVLNLVVKSDVQGSLEAISEALRK
LSTEKVRINIIHGGAGAISESDILLASASDAIIIGFNVRPTAKVKDIAEQENVDIRFYDI
IYKLVDEVKSAMEGMLAPVQREVYLGQVEVRQTFGVPKVGTIAGCHVADGKITRNAGVRL
LRDGVVVYTGKITSLKRFKDDMKEVMKGYECGVGLENFNDIKIGDIIEAFEMVEEAATL