Protein Info for DvMF_2485 in Desulfovibrio vulgaris Miyazaki F

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00005: ABC_tran" amino acids 27 to 205 (179 residues), 99.6 bits, see alignment E=2.5e-32

Best Hits

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to dvm:DvMF_2485)

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMY5 at UniProt or InterPro

Protein Sequence (276 amino acids)

>DvMF_2485 ABC transporter related (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MELNICDPEPSLRVTGLRVSFHGRPAVKDASLDLPRAGVTVLLGRSGSGKTSFLRALNRL
NECFPGCETTGSIVLYPGSPHGGRHADGTPCDVPEPDGPCDILGPDGPALTELRRRVGMV
FQTPNVLPMSIRRNLLLPLELVRGPLPDAPARMQAVLTDVGLWDDVRQRLDRPAAQLSGG
QQQRLCLARMLILQPDVLLLDEPTASLDAATTRDVEQLVRRLATDRPVLMVSHSLGQAMR
LADRVVIFADGRPQREFTPADLDGDAGREALMQALL