Protein Info for DvMF_2483 in Desulfovibrio vulgaris Miyazaki F

Annotation: multi-sensor hybrid histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1071 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 292 to 311 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 376 to 501 (126 residues), 66.8 bits, see alignment E=1e-22 PF13188: PAS_8" amino acids 380 to 431 (52 residues), 36.4 bits, see alignment 1.2e-12 amino acids 506 to 561 (56 residues), 15.5 bits, see alignment 4.6e-06 PF00989: PAS" amino acids 381 to 436 (56 residues), 31.3 bits, see alignment 6.3e-11 PF08448: PAS_4" amino acids 386 to 496 (111 residues), 23.2 bits, see alignment E=2.4e-08 PF13426: PAS_9" amino acids 391 to 493 (103 residues), 36.4 bits, see alignment E=1.9e-12 PF00512: HisKA" amino acids 641 to 706 (66 residues), 69.5 bits, see alignment 7.4e-23 PF02518: HATPase_c" amino acids 753 to 869 (117 residues), 85.4 bits, see alignment E=1.4e-27 PF00072: Response_reg" amino acids 942 to 1059 (118 residues), 97.6 bits, see alignment E=1.8e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2483)

Predicted SEED Role

"PAS/PAC sensor hybrid histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMY3 at UniProt or InterPro

Protein Sequence (1071 amino acids)

>DvMF_2483 multi-sensor hybrid histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRPHMFSIRVTLVWVALLAALPSFGVILYDSHRLASQLKVEAEASVTRAARSIAALQERV
AGGARQTLTVLAALPDVRRLDPTACETIFREVLAGNTTLLNLMALDANGDLIASGRQTIS
PPGQAPFNLADRLYFRAAVRDKRFSNGEYVLARTLHESTFHFALPLVDGEGRVYGVLAAP
LRLDQYNPLFDKLNLPPGSVLSVSDHRGVRLAYHPQNDANPVGKPIREEILNILRTMPDE
GLFTRESSDGTVRLYGFTRIRLHPESAPYLNVMVGIPEDAVLAPMRAARNHALLLLGGAM
AVTLAVAWSIGGRLVARPLSHIAATATRIGEGQLGARTGIRHDMGEIGQLAFSVDTMAAI
LASRQGEREAFTAELRDNEARYRAVFDNAMDAILLADADTGIILDANRAAQQIFEYTRDE
LLGMHQRQLHPDRTHRNGFGGRFNTLREQPLEIPAEMPMRTRTGIERDMLVKAKVLRVGS
REVAVAMLHDITERRQSEQQLREVEARFRSIVEGAPLGLLLLTLDQAEHLRIEAVNPTAD
TALHITGRGMLGRRVTEALPGIAATNLPTIFVGIARKGGEFSVTAHASAGWLPAGWAFVD
LWVFRTGNRQIAVMFADVTRRTRAEDELRQTRDTAEKANRSKSEFIAVMSHEVRTPINGI
MGMLQLLRGSHLSGEQEDCVDTALGASRNLLRILDDILDISRMEAGALPLVEEPFTVAQV
TEPVHAMLTPQAKAKGLTFEMQVAPDLPPELAGDAGRIRQVLVNLVSNAVKCTDTGGVRV
EMYPLPRCGQAGRTCIHMAVIDTGIGFAPERLRTLFENYATGSAATARPGGTGLGLGIVR
RLVLLMGGTICVATTPGEGTEFHITLPLHTEAEFPKESRAARRTASPSASPGTAGPAPHA
AGVAQAARPPDAAPPHPQAATPPVADAAAGKEDAAPGAPPRILVVDDDEVNLITAQRLLT
RLGYIADRAASGRQALEMLGRDHYDAVLMDIQMPDMDGMEATRQIRMREAVLPGTTPPWV
PVLALTAHAMLGDRERFLAAGMNDYLAKPIEIDQLDARLRAHLNSPPRSHA