Protein Info for DvMF_2480 in Desulfovibrio vulgaris Miyazaki F
Annotation: Rubredoxin-type Fe(Cys)4 protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RUBR_DESVM: Rubredoxin (rub) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)
KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2480)MetaCyc: 53% identical to MTBE monooxygenase rubredoxin component (Methylibium petroleiphilum PM1)
1.14.13.M36 [EC: 1.14.13.M36]
Predicted SEED Role
"Rubredoxin" in subsystem Rubrerythrin
MetaCyc Pathways
- methyl tert-butyl ether degradation (1/10 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.14.13.M36
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P15412 at UniProt or InterPro
Protein Sequence (52 amino acids)
>DvMF_2480 Rubredoxin-type Fe(Cys)4 protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F) MKKYVCTVCGYEYDPAEGDPDNGVKPGTAFEDVPADWVCPICGAPKSEFEPA