Protein Info for DvMF_2479 in Desulfovibrio vulgaris Miyazaki F

Annotation: beta-lactamase domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF00753: Lactamase_B" amino acids 36 to 226 (191 residues), 39.9 bits, see alignment E=6.9e-14 PF19583: ODP" amino acids 36 to 227 (192 residues), 76.8 bits, see alignment E=3.2e-25 PF00258: Flavodoxin_1" amino acids 257 to 388 (132 residues), 53.7 bits, see alignment E=3.8e-18

Best Hits

Swiss-Prot: 59% identical to ROO_DESGG: Rubredoxin-oxygen oxidoreductase (roo) from Desulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2479)

Predicted SEED Role

"rubredoxin-oxygen oxidoreductase" in subsystem Rubrerythrin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMX9 at UniProt or InterPro

Protein Sequence (402 amino acids)

>DvMF_2479 beta-lactamase domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHALEIKKDIHWVGVVDHNSRDFHGYSLSPQGTTYNAYVVMDEKVTLFDTVKHEFLPTLL
CRLSQVVAPEKIDYIVCNHLEPDHAGALAEMVARCKPEKIFCSPMGLKAMEAHFDITGWP
VQVVKTGDSISLGKRTVTFVETRMLHWPDSMVSYIPEDKLLICNDAFGQNIASTERYADE
IDRSALLHAMKEYYHNIVLPFSPIVLKTLDAIAELKLDIDMLAPDHGLIFRGHDEVQFAF
DTYRRYAEQKPQKRAVIVFDTMWHSTEKMAHAIADGLEAGGVPTRIMWLKANHHSAVMTE
LADCGAVIVGSPTHNNGILPEVAKMLTYMKGLRPQNRIGAAFGSFGWSGESVKAITEWLE
SMGMELPAEPVKVKHVPTHDTYGKCFELGKTVAAALTAKCGG