Protein Info for DvMF_2469 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12800: Fer4_4
  • amino acids 11 to 25 (15 residues), 10.8 bits, see alignment (E = 0.0003)
  • amino acids 89 to 104 (16 residues), 22.2 bits, see alignment (E = 6.5e-08)
• PF13247: Fer4_11
  • amino acids 54 to 146 (93 residues), 91.8 bits, E=1.4e-29
• PF13187: Fer4_9
  • amino acids 58 to 104 (47 residues), 29.4 bits, E=3.2e-10
• PF13237: Fer4_10
  • amino acids 58 to 102 (45 residues), 25.6 bits, E=4.9e-09
  • amino acids 84 to 138 (55 residues), 31.5 bits, E=7.4e-11
• PF12838: Fer4_7
  • amino acids 59 to 105 (47 residues), 30.5 bits, E=2.1e-10
  • amino acids 90 to 141 (52 residues), 27.5 bits, E=1.8e-09
• PF12837: Fer4_6
  • amino acids 83 to 106 (24 residues), 35.6 bits, see alignment (E = 2.9e-12)
• PF12797: Fer4_2
  • amino acids 83 to 103 (21 residues), 29.3 bits, see alignment (E = 2.8e-10)
• PF00037: Fer4
  • amino acids 84 to 106 (23 residues), 33.9 bits, see alignment (E = 9.4e-12)
• PF12798: Fer4_3
  • amino acids 91 to 105 (15 residues), 19.5 bits, see alignment (E = 6.8e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2469)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

• NADH to dimethyl sulfoxide electron transfer (2/2 steps found)
• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• hydrogen to dimethyl sulfoxide electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

See B8DMW9 at UniProt or InterPro

Protein Sequence (188 amino acids)

>DvMF_2469 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKKQLGFLVDTEKCIGCFTCAMACKNVYHQQKGIVWRQVHPMGESIYPHRERAWLSLACN
HCENPVCLEQCPVKAYTKREDGIVVHDQDACIGCGNCVRSCPYGAPKMNPVEKRAEKCSM
CWQRIDAGLDPACVHSCPVGALSIADISTARLDGWVQYPAGYPESKRLNPSTRFKAPRQP
REVRRNDA