Protein Info for DvMF_2469 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF12800: Fer4_4" amino acids 11 to 25 (15 residues), 10.8 bits, see alignment (E = 0.0003) amino acids 89 to 104 (16 residues), 22.2 bits, see alignment (E = 6.5e-08) PF13247: Fer4_11" amino acids 54 to 146 (93 residues), 91.8 bits, see alignment E=1.4e-29 PF13187: Fer4_9" amino acids 58 to 104 (47 residues), 29.4 bits, see alignment E=3.2e-10 PF13237: Fer4_10" amino acids 58 to 102 (45 residues), 25.6 bits, see alignment E=4.9e-09 amino acids 84 to 138 (55 residues), 31.5 bits, see alignment E=7.4e-11 PF12838: Fer4_7" amino acids 59 to 105 (47 residues), 30.5 bits, see alignment E=2.1e-10 amino acids 90 to 141 (52 residues), 27.5 bits, see alignment E=1.8e-09 PF12837: Fer4_6" amino acids 83 to 106 (24 residues), 35.6 bits, see alignment (E = 2.9e-12) PF12797: Fer4_2" amino acids 83 to 103 (21 residues), 29.3 bits, see alignment (E = 2.8e-10) PF00037: Fer4" amino acids 84 to 106 (23 residues), 33.9 bits, see alignment (E = 9.4e-12) PF12798: Fer4_3" amino acids 91 to 105 (15 residues), 19.5 bits, see alignment (E = 6.8e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2469)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMW9 at UniProt or InterPro

Protein Sequence (188 amino acids)

>DvMF_2469 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKKQLGFLVDTEKCIGCFTCAMACKNVYHQQKGIVWRQVHPMGESIYPHRERAWLSLACN
HCENPVCLEQCPVKAYTKREDGIVVHDQDACIGCGNCVRSCPYGAPKMNPVEKRAEKCSM
CWQRIDAGLDPACVHSCPVGALSIADISTARLDGWVQYPAGYPESKRLNPSTRFKAPRQP
REVRRNDA