Protein Info for DvMF_2468 in Desulfovibrio vulgaris Miyazaki F

Annotation: molybdopterin-containing oxidoreductase membrane anchor subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF04976: DmsC" amino acids 4 to 186 (183 residues), 59.9 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2468)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMW8 at UniProt or InterPro

Protein Sequence (265 amino acids)

>DvMF_2468 molybdopterin-containing oxidoreductase membrane anchor subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MNSMELPLVIFTVLSQGAVGLVALTATRQWASDGGSDMAQAPRTAWLTAVALLALGAFAA
MFHLGHMGGAVRTLANLESAWLSREGLALGATGALLLAGYLSPGLRARGAATVAAVLGVT
AVLVTSMTYAPAGFPALNNALPGVFFLLTAAVLGPALAAPFLPDAHQPAAMRALRAALLV
SLVINLVVPCVWLSGGTVMRLTGEAFLAAPLYWLRLALMAASYALARGGRMPAWMLPLLA
AQELLGRALFFMLPVHASVNIGNPF