Protein Info for DvMF_2454 in Desulfovibrio vulgaris Miyazaki F

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 TIGR00229: PAS domain S-box protein" amino acids 107 to 223 (117 residues), 46.6 bits, see alignment E=3.7e-16 PF08448: PAS_4" amino acids 123 to 223 (101 residues), 31.9 bits, see alignment E=3.4e-11 PF00989: PAS" amino acids 123 to 219 (97 residues), 24.7 bits, see alignment E=4.9e-09 PF08447: PAS_3" amino acids 129 to 209 (81 residues), 52.7 bits, see alignment E=1e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 230 to 393 (164 residues), 120.7 bits, see alignment E=5.3e-39 PF00990: GGDEF" amino acids 233 to 388 (156 residues), 135.1 bits, see alignment E=4.8e-43 PF00563: EAL" amino acids 411 to 647 (237 residues), 254.7 bits, see alignment E=2e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2454)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMV5 at UniProt or InterPro

Protein Sequence (663 amino acids)

>DvMF_2454 diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSDQKGQDSAESVWHAAATGHGQALGPVNGHDPRSGGTPPDSGRDPLPDLPPPAAPLSAV
ASGHTPPASPQISPEPVPYDDVPSRARHAVPFPHAPSPLPDGDTAQSFRVLADHLADWES
WEDADGKVVFVTPACQRITGYSLESFRANARFIEGIMHPEDLPLWRKHREMVASGAEMVE
VEVRVRTQDGRERWLACTSRRLHDAEGTSQGVRFSGRDVTDRKIMLTQMKHQAWHDPLTG
LPNRALCLDRIDRSLHRARRGVDNVCAVAFLDLDRFKVVNDSMGNSAGDQVLREVARRLA
ENTRTIDTVSRLGSDEFILLLDEVRSEEEALITVQRICTSLEPPLEVAGRQIRISASVGV
VMNRGGGNADEMLRNANIAMHHVKEHGGDGMAVFQPSMLEQAMNLMQLEIDLHRALDNNE
FFLVYQPIMSLHDRRLTGFEALVRWNHPDRGIVGPSEFIPVSESTGQIHQVGHWVLAEAC
RALAAWREQQPSMRSVIMHVNLSARQLSQPGLVEQVAAVLRETGLPARCLKLEVTETMLM
ENPDYANLVLRRLKEIGVRLCIDDFGTGYSSLSYLQQFPIDTLKVDQSFVARMCREPGHF
KIVQAVVALAHSLGLDVVAEGVEEEEQRIMLSELSCEGGQGYLFSRPVPGEDVPGLFVDR
SRH