Protein Info for DvMF_2435 in Desulfovibrio vulgaris Miyazaki F

Annotation: type III secretion system ATPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 TIGR01026: ATPase, FliI/YscN family" amino acids 18 to 437 (420 residues), 592.2 bits, see alignment E=5.7e-182 TIGR02546: type III secretion apparatus H+-transporting two-sector ATPase" amino acids 19 to 437 (419 residues), 685.3 bits, see alignment E=2.7e-210 PF02874: ATP-synt_ab_N" amino acids 27 to 91 (65 residues), 33.8 bits, see alignment E=5.9e-12 PF00006: ATP-synt_ab" amino acids 148 to 357 (210 residues), 298.9 bits, see alignment E=3.1e-93 PF18269: T3SS_ATPase_C" amino acids 364 to 434 (71 residues), 89.8 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 66% identical to YSCN_YEREN: Probable ATP synthase YscN (yscN) from Yersinia enterocolitica

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 100% identity to dvm:DvMF_2435)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMT6 at UniProt or InterPro

Protein Sequence (438 amino acids)

>DvMF_2435 type III secretion system ATPase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MAFEYIGSLLEEAVHSGPTVEVRGRVEQVVGTIIRAVVPGVKVGELCILRNPWENWTLRA
EVVGFVKQVALLTPLGDLQGVSPATEVIPTGEILSIPVGEDLLGRVLDGLGEPMDGGPPL
KPRTRYPVYAQPPNPMQRRIIDRPISLGLRVLDGVLTCGEGQRMGIFAAAGGGKSTLLSS
IIKGCSADVCVLALIGERGREVREFIEHDLGPEGRKKAVLVVSTSDRSSMERLKAAYTAT
AIAEYFRDQRRSVLLMMDSVTRFGRAQREIGLAAGEPPTRRGFPPSVFSTLPRLMERAGN
SDKGSITALYTVLVEGDDMTEPIADETRSILDGHIVLSRKLAAANHYPAIDVQASVSRVM
NAIVDKEHKAAAQKLRKVLAKYAEVELLVQIGEYKRGSDKEADEALDRVAAVNAFLRQGL
DERSGFDDTLAALRKVVE