Protein Info for DvMF_2423 in Desulfovibrio vulgaris Miyazaki F

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 52 to 71 (20 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2423)

Predicted SEED Role

"Type III secretion host injection protein (YopB)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMS4 at UniProt or InterPro

Protein Sequence (338 amino acids)

>DvMF_2423 hypothetical protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSALTIGGLGAAGGVSGVSGDDLTTRRTTANGTLPPAGDGAGGAAGGDLPVLAAPAAPAG
ALALETLMAAIGNAERRQACQAGVDQIKGKAAEQAKVNQDRLEQIAKQLDEMRSKSVLNG
FLKAFKIIGIIVGAIAAIATTAVGVATGNPLLIAAGVMAAAMTVDAIMSEASGGKVSFMA
GMTELGKACGMDDETAKWFGFAMQMVVTAASVALSLGAGFANAGASAANMSSKAAETALN
VASRAQQIAQFTSAGVAVGTGAGTIAGAVIDYRIASSQADAKELDAILERIRQAIDMEHD
FLESEMQRAEDLMGKVGDIVKENAEAQTVILGGTPALA