Protein Info for DvMF_2351 in Desulfovibrio vulgaris Miyazaki F

Annotation: aminodeoxychorismate lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details TIGR00247: conserved hypothetical protein, YceG family" amino acids 33 to 362 (330 residues), 211.4 bits, see alignment E=9.9e-67 PF02618: YceG" amino acids 66 to 358 (293 residues), 271 bits, see alignment E=6.2e-85

Best Hits

KEGG orthology group: K07082, UPF0755 protein (inferred from 100% identity to dvm:DvMF_2351)

Predicted SEED Role

"FIG004453: protein YceG like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIJ4 at UniProt or InterPro

Protein Sequence (620 amino acids)

>DvMF_2351 aminodeoxychorismate lyase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPSSASPTPSAQSPASPAPGHPVVRILLRVLAALVLLVLLACGYAGYDAWRFLHTPPASP
GADVYVDVEPGATFDKVTRQLVDKGAVASDWRFKLLAHYHGWETSLKAGRFLVHSNWAPF
RVLDQLVNGQPVLSRITLREGLTWWETARLLEVEGFVTVEDFRAVITDPAFLRHWGIPFD
TAEGFLFPDTYLIKKPTTPDRESARAVAGRMVDTFWRRAAQVWPDGRPARDELRRLIILA
SIVEKETGQPSERGRVAGVYANRLRTGMLLQADPTTIYGLGDTFDGNLRRSHLQDAANPY
NTYRRPGLPPGPICSPGLESLRAATTPEKHGYFYFVSRNDGSHQFSATLDEHNRAVNRYQ
RAGRAKGGDQAATQGTPATPANPAAPQGATPPADAAATPASTDTEATATGAQDKAAASAA
EGKPSVSAAGDKNADAGAAPSGNPAPDAEAAKPAAQPAPADTAGTGSTGTSAAPAPAVPV
VSAVPAAPQPAQAPQAPQSLKVSPGAKPAPTPLPRTSAPAANGTTGATGANATAPTSAGV
RAPTAPREAAQSARSPLTGAGATGSTTTTGTAGETSSTATATRPAPATPEAAAAPATPAT
PTSPVPTVTETPPASAPTTP