Protein Info for DvMF_2325 in Desulfovibrio vulgaris Miyazaki F

Annotation: ectoine/hydroxyectoine ABC transporter solute-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02995: ectoine/hydroxyectoine ABC transporter solute-binding protein EhuB" amino acids 40 to 278 (239 residues), 194.9 bits, see alignment E=8.4e-62 PF00497: SBP_bac_3" amino acids 44 to 259 (216 residues), 83.8 bits, see alignment E=4.6e-28

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 100% identity to dvm:DvMF_2325)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DIG8 at UniProt or InterPro

Protein Sequence (299 amino acids)

>DvMF_2325 ectoine/hydroxyectoine ABC transporter solute-binding protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPRFPRSAPSLLGVIAVVCAVTPLLYALLELPDPDNAAWRGGTIRVGYALEPPYAYRTPE
GTVTGEAPEVARAALTRAGITRVRWVLGDFNALIPDLLAGHIDMIAAGMFITPDRAARVA
FSLPTSSVGQGLLVRRGNPRGLHDYASLAERSDVTLAVLDGAVEHRQLLLLNMPAERLFP
VSDVHAGMTAVRKGRVDGLALSGPTVVLLARQHPEELEAARPFTQPVIDGKSVAGLCAFA
FRKEDAPLADRVNEQLRAFVGTPEHLALVRPFGFDGSTLPPWSAPGTPHGQDGRNGPGQ