Protein Info for DvMF_2300 in Desulfovibrio vulgaris Miyazaki F

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 936 transmembrane" amino acids 76 to 101 (26 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details PF00672: HAMP" amino acids 296 to 347 (52 residues), 35.6 bits, see alignment 3.3e-12 TIGR00229: PAS domain S-box protein" amino acids 384 to 497 (114 residues), 46.5 bits, see alignment E=3.8e-16 PF13188: PAS_8" amino acids 384 to 422 (39 residues), 24.2 bits, see alignment (E = 8.5e-09) PF08448: PAS_4" amino acids 385 to 490 (106 residues), 27.2 bits, see alignment E=1.4e-09 PF13426: PAS_9" amino acids 390 to 490 (101 residues), 40.4 bits, see alignment E=1.1e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 499 to 662 (164 residues), 134.9 bits, see alignment E=2.2e-43 PF00990: GGDEF" amino acids 502 to 658 (157 residues), 152.3 bits, see alignment E=3.6e-48 PF00563: EAL" amino acids 679 to 913 (235 residues), 223.3 bits, see alignment E=1.1e-69

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2300)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQX2 at UniProt or InterPro

Protein Sequence (936 amino acids)

>DvMF_2300 diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRPEGRSPFVPVAGGQPADRGGQPDPSGRVHASGPGTPTPEWLNPPEAPKSPEQRDGAGT
SGTARSSHPPRPGFGIAFKAGGLAFVAGVMIIAAILGMIIPYQQGVLRRGMESQADKLAS
SVAEVAASALAAQDYAALVDHCTGVLQRQSGLEYIVVTRMDGSSLAFRRGGWGFQAAPQA
SAGVAAKTEPSSGFRLGLPPGLDVPDAPGTAKSPASPNPADAVSPGTFPGAFTGGAADGP
EVYHHVLPVERGGISICTVSVGLALDGYRAEQRAAWWHIGALTAMAVLVALATALLLSRT
VTRTVLRLSGWVRSIGPGNMGQRIRIDTGDELEGLANAFNGMLDLLEASQRELNEAHREL
ERRVRDRTAQLCDANAKLHLMGEVFTHAVEGIFITDSAGTVVAVNPAFERITGVDAQSMV
GRLSPALGMVPVNGTRSVWDEMLEHGSWIGETRGPHRDGWQIPQWLSLVSIRDETGVILN
CVGVFSDITDIKQKEAQITHQANHDDLTGLPNRKHIFELLHDAIARASVRGQKLAVVFID
MDGFKFINDSYDHATGDQLLCDVARRLRAALRPGDMLGRLGGDEFVAAVGGISDKGHLDG
IMRRLFETFAEPFEYGGMGFSVTASFGVSVYPDDGDSANALLSRADIAMYRAKDMGKNAI
AVFCEEQCLEFTRRYRMDQEIKAAIAGREFRLVYQPIADARTLRVRKVEALLRWERDGAV
VAPPSVFIPVAESSNAIREITRLVVEMACVQHAAWRLEGLTLPVAVNISSRCLNSDETIS
HIAACLNAYDVPPDALEVEITETSLMQNYERGNAMLCTLRDLGVRVSLDDFGTGYSSLQY
LARMPIHALKIDRTFVQELLEEGGSLEIVETILGLARSLRLATVAEGVETAAQLSALRGM
GVDYLQGYCLGRPLPADDILTLCRRGMRLVPRDVER