Protein Info for DvMF_2287 in Desulfovibrio vulgaris Miyazaki F

Annotation: flagellar M-ring protein FliF (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 440 to 462 (23 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 7 to 463 (457 residues), 320.4 bits, see alignment E=1.4e-99 PF01514: YscJ_FliF" amino acids 45 to 221 (177 residues), 212.1 bits, see alignment E=5.9e-67 PF08345: YscJ_FliF_C" amino acids 255 to 414 (160 residues), 145.8 bits, see alignment E=1.4e-46

Best Hits

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 100% identity to dvm:DvMF_2287)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQW0 at UniProt or InterPro

Protein Sequence (539 amino acids)

>DvMF_2287 flagellar M-ring protein FliF (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MAPALADVIQKAKGFWERISISQRIFIAGLAVAVVAVFFGLVFWMNRPDYRVLYSNLSPE
DASRVVKLLQADKVAYKLESGGSSITVPADKVYDLRLKVAGEGNLVGQGIGFEIFDQVKV
GQTDFVQKINYQRALQGELSRTISEFPNVESARVHLVIPHRSLFIEEQQKPSVSVVLKLR
DSSKKLESKDVQAIVNLVVMAVEGLDKYKVSIADTTGKILYAPDEDGSITGMTTTQLDHK
LRMQQTLERRIEELLYPVLGAGKIIAKVNADLDFSQRTIRKELYDPEKTVVRSEQRSEES
QRGRSNLEAGSPDANFRGDSPTGGASTQEGNRETRTTNYEINKEEQNIVAQVGDISRLTV
AVIVDGTYEKGADGQWAFVPRKAEDVERIRQLVANAVGYDRARGDTIEVSSISFGGPDVP
QESSLPQLVMDYALRLGKPLLNALLVFLFLVLVVRPVVLAMIRPRVEGEMIEGLEGLPEG
EERLALIEGDEEVDALDALKKIEDIKAHALQMAEQNMDQAVSIIRSWLKHGDGPKVGAA