Protein Info for DvMF_2283 in Desulfovibrio vulgaris Miyazaki F

Annotation: TPR repeat-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF13181: TPR_8" amino acids 13 to 35 (23 residues), 23.6 bits, see alignment (E = 2.6e-08) PF13174: TPR_6" amino acids 13 to 33 (21 residues), 12.6 bits, see alignment (E = 0.00012) amino acids 146 to 175 (30 residues), 15 bits, see alignment 2e-05 PF13432: TPR_16" amino acids 17 to 68 (52 residues), 27.4 bits, see alignment E=2.6e-09 amino acids 122 to 175 (54 residues), 22.7 bits, see alignment E=7.5e-08 PF14559: TPR_19" amino acids 21 to 76 (56 residues), 26 bits, see alignment E=6.2e-09 amino acids 122 to 184 (63 residues), 41.1 bits, see alignment E=1.2e-13 PF07721: TPR_4" amino acids 44 to 65 (22 residues), 11.8 bits, see alignment (E = 0.00022)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2283)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQV6 at UniProt or InterPro

Protein Sequence (186 amino acids)

>DvMF_2283 TPR repeat-containing protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSNHLDYEINKELGECYLFMGDLEKAEEYYRKAAGSNGVHPDPYLGLATIAVQRGNLEAA
LVLYRKAANIEANDKSLAGMGLVEMETGAHAEAFDHFVAALGMNPGNLVAMNGLLRLGYH
LGRIEEVVAHLRAFLELSPEKDNVRFSLAGCLISLGRKDEARAELEVILDRAPDHADARE
MYALIG