Protein Info for DvMF_2282 in Desulfovibrio vulgaris Miyazaki F

Annotation: permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 49 to 67 (19 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details PF03773: ArsP_1" amino acids 34 to 327 (294 residues), 249.5 bits, see alignment E=2.1e-78

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to dvm:DvMF_2282)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQV5 at UniProt or InterPro

Protein Sequence (330 amino acids)

>DvMF_2282 permease (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MAVCLAAWWAVYLNLPAASRSLTYGMLGLTPGSHLGEAVEFFLYDTPKVLMLLSLVVFGI
GLVRSFFTPQRTRRLLAGRGEAVGNVLAALLGIVTPFCSCSAVPLFIGFVSAGVPLGVTF
SFLVSAPMINEIAVVMLYGLLGWKVAALYAGTGLAIAIVSGWIIGRLGMERHIEGWVLQV
RAEAEQMHDAGLSWSGRIDYGVQAMRDIVGKVWPWVVLGIAVGAGIHGYVPEGFMASIMG
RGAWWAVPLAVAIGIPMYSNAAGMIPVVQALLGKGAALGTVLAFMMAVIALSLPEAVMLR
RVLKPRLVAVFFGVVGLGIMLVGYLFNALV