Protein Info for DvMF_2214 in Desulfovibrio vulgaris Miyazaki F

Annotation: flagellar biosynthesis protein FliO (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 62 to 83 (22 residues), see Phobius details TIGR03500: flagellar biosynthetic protein FliO" amino acids 70 to 143 (74 residues), 60.2 bits, see alignment E=7.9e-21 PF04347: FliO" amino acids 82 to 182 (101 residues), 53.6 bits, see alignment E=9.4e-19

Best Hits

KEGG orthology group: K02418, flagellar protein FliO/FliZ (inferred from 100% identity to dvm:DvMF_2214)

Predicted SEED Role

"Flagellar biosynthesis protein FliO" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQN8 at UniProt or InterPro

Protein Sequence (191 amino acids)

>DvMF_2214 flagellar biosynthesis protein FliO (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRAAISANATLGDAAQSLPHAAGQVAASAADAVNATMAHANATVGASDGLAAAAVPAFSW
GGYIQAVGVLFLLVGLLWLALWAVRRHGGLFRAVPGAGGFSRDDLRLEAQLPIGPRKGLM
VVRFLNKRLLLGVTDQQITLLTEQDLDHEHGSDDAISDAGSLSDQPGGRGSGGFSSVLGR
ALGKGRTPSGN