Protein Info for DvMF_2204 in Desulfovibrio vulgaris Miyazaki F

Annotation: aminotransferase class I and II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 46% identical to AAT_GEOSE: Aspartate aminotransferase (aspC) from Geobacillus stearothermophilus

KEGG orthology group: K00812, aspartate aminotransferase [EC: 2.6.1.1] (inferred from 100% identity to dvm:DvMF_2204)

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

superpathway of aromatic amino acid biosynthesis (17/18 steps found)
superpathway of L-isoleucine biosynthesis I (12/13 steps found)
aspartate superpathway (20/25 steps found)
superpathway of L-phenylalanine biosynthesis (9/10 steps found)
superpathway of L-tyrosine biosynthesis (9/10 steps found)
superpathway of L-threonine biosynthesis (6/6 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-tyrosine biosynthesis I (3/3 steps found)
L-glutamate degradation II (2/2 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (9/12 steps found)
3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
L-aspartate biosynthesis (1/1 steps found)
L-aspartate degradation I (1/1 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (13/18 steps found)
(R)-cysteate degradation (2/3 steps found)
indole-3-acetate biosynthesis VI (bacteria) (2/3 steps found)
L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
L-tyrosine degradation II (1/2 steps found)
atromentin biosynthesis (1/2 steps found)
malate/L-aspartate shuttle pathway (1/2 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tryptophan degradation VIII (to tryptophol) (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
superpathway of L-aspartate and L-asparagine biosynthesis (2/4 steps found)
anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
L-asparagine degradation III (mammalian) (1/3 steps found)
L-phenylalanine degradation II (anaerobic) (1/3 steps found)
L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
sulfolactate degradation III (1/3 steps found)
TCA cycle VIII (Chlamydia) (3/6 steps found)
superpathway of sulfolactate degradation (3/6 steps found)
trans-4-hydroxy-L-proline degradation I (2/5 steps found)
4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
L-tyrosine degradation I (1/5 steps found)
L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
superpathway of plastoquinol biosynthesis (1/5 steps found)
coenzyme M biosynthesis II (1/6 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
C4 photosynthetic carbon assimilation cycle, NAD-ME type (4/11 steps found)
C4 photosynthetic carbon assimilation cycle, PEPCK type (6/14 steps found)
(S)-reticuline biosynthesis I (3/11 steps found)
superpathway of anaerobic energy metabolism (invertebrates) (7/17 steps found)
indole-3-acetate biosynthesis II (3/12 steps found)
rosmarinic acid biosynthesis I (1/10 steps found)
superpathway of rosmarinic acid biosynthesis (1/14 steps found)
superpathway of chorismate metabolism (31/59 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (3/27 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQM8 at UniProt or InterPro

Protein Sequence (390 amino acids)

>DvMF_2204 aminotransferase class I and II (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRISDRLTRIKPSATLAVNAKALELKAKGVQVVSLAVGEPDFPTPEHVREAAKTAIDQGF
TRYTQVPGIPELRQAVCGYFARFYGVEAPMEATVVTNGGKQALYNLFQCLLNPGDEVLVP
APYWVSYPALVELAGGVPVFVASPAERGFKVTPEELDRAVTPKTRVLLLNSPSNPTGACY
SRAETDAIMEWAIARDLFVVSDEIYDRLVYEPAEAVSVCDWWERHPENVAVVNGLAKTFA
MTGWRVGYALAHPDLIKAMTKIQGQSTSNICSVAQKAALAALTGPYDAVEEMKKSFRRRR
DLAHGIVSSWPGVICPKPDGAFYLFADMRALFTPALPDSASLCTYIMEQANVALVPGAAF
GDDACLRFSYAVSDDTLMIALDKVAKVLFG