Protein Info for DvMF_2201 in Desulfovibrio vulgaris Miyazaki F

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details PF00512: HisKA" amino acids 267 to 331 (65 residues), 61.2 bits, see alignment E=1.2e-20 PF02518: HATPase_c" amino acids 373 to 478 (106 residues), 83.6 bits, see alignment E=2.1e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2201)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQM5 at UniProt or InterPro

Protein Sequence (480 amino acids)

>DvMF_2201 integral membrane sensor signal transduction histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPRRFELPGGLPFGFARFLSWVSLVLILATSIVMSVIITDSARNTMFRKQQEFASLLAEN
LNHQIYRRFTLPTLVGFGRIALRQPVQYERLDQLVQSVVHGLQVSRVRIYDHGKIVSYST
DRADLGRTDLAGPEVTVALRDEDPSYTVDANISFWQALFTPRLEPGSFILRTTYPLRVEN
RLGRIDDDDDGPIMGVLEMTQDITNDTRSIIAFQWLIIGTASLSSLVLFGMLLVFIRRAE
RVMAERMQEKQRLERELHQHEKLAGMGRVVASIAHEIRNPLGIIRSSAELLLKRPSSSDP
VTARILQAIYDEAKRLSQTVNDFLDYARPRQPRQDPVEADGVLDRVLGFLEGELARREVA
VARETEPGITISGDGDLLYRAFYNIMVNALQAMDGPGSITVTSRRDGDAVELAFRDSGPG
FDPANRERLLDPFFTTKDDGTGLGLPIVNSIITSHGGSLRIDNAPEGGAVVYVRLPLRAE