Protein Info for DvMF_2192 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF81 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 68 to 99 (32 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 256 to 281 (26 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details PF01925: TauE" amino acids 66 to 365 (300 residues), 98.2 bits, see alignment E=3.1e-32

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to dvm:DvMF_2192)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQL6 at UniProt or InterPro

Protein Sequence (380 amino acids)

>DvMF_2192 protein of unknown function DUF81 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSKHTKHLLLLAAVVAVSLLWFEPAWADKLSDAIDGAVQAGKVKADAPAGFLGIPGAPHV
SPILSFAWAVWVGWIFSTVGAFGGVMAGVGHMSVFGLGGYAKSLGKDLPLNKVATDSIKA
SNQWLVGFSALISSFNYYKMGRLVLPLALALGAGSLAGAWASAYFFAGKVSFSQYQGYFG
LFVLVLGLYLFWETSPAGQASKKKAKEAAKAFEETVKKIKSGEQVDEKSIGVHVISTSLT
KCVFTFSGVEFSFNPILPVVGGIVISAIAAFLGVGGGFLLVPFLTSISQLPMYLAAGTSA
LAVLISMVTSIATLVSKGTPLDWTMIGTELVGIFIGSVIGPRTSKYFSDTLLKRIFIVLA
LYVGIDYVLRGFFNIKMFGG