Protein Info for DvMF_2178 in Desulfovibrio vulgaris Miyazaki F

Annotation: export-related chaperone CsaA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 TIGR02222: export-related chaperone protein CsaA" amino acids 15 to 120 (106 residues), 139.5 bits, see alignment E=1.9e-45 PF01588: tRNA_bind" amino acids 23 to 117 (95 residues), 30.8 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 55% identical to CSAA_BACSU: Probable chaperone CsaA (csaA) from Bacillus subtilis (strain 168)

KEGG orthology group: K06878, tRNA-binding protein (inferred from 100% identity to dvm:DvMF_2178)

Predicted SEED Role

"Protein secretion chaperonin CsaA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQK2 at UniProt or InterPro

Protein Sequence (121 amino acids)

>DvMF_2178 export-related chaperone CsaA (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTTAAAASGLPAITWDDFEKVELRTGTIVQVEPFPEARSPAWKVWADFGPGIGVLKSSAR
ITHLYEAHDLLGRQIIGVVNFPPRQIGPFRSEFLVTGFAQADGSVVLAVPERPVDNGLKL
A