Protein Info for DvMF_2076 in Desulfovibrio vulgaris Miyazaki F

Annotation: GPR1/FUN34/yaaH family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 54 (24 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 122 to 139 (18 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 2 to 177 (176 residues), 147 bits, see alignment E=3e-47

Best Hits

Swiss-Prot: 67% identical to SATP_ECOLI: Succinate-acetate/proton symporter SatP (satP) from Escherichia coli (strain K12)

KEGG orthology group: K07034, (no description) (inferred from 100% identity to dvm:DvMF_2076)

MetaCyc: 67% identical to acetate/succinate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN0-571

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQA0 at UniProt or InterPro

Protein Sequence (183 amino acids)

>DvMF_2076 GPR1/FUN34/yaaH family protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
METKLANPAPLGLMGFGMTTILLNIHNAGFFPISSMILAMGIFYGGIAQVIAGIMEFKKG
NTFGTTAFTSYGLFWLTLVALIVMPKLGWAEPTPHAYMGFYLAMWGLFTFFMFLGTLKGK
TTLKFIFLSLTVLFALLAIRDFTGSELIGTIAGWEGIVCGASACYLAMAEVLHEQYGRVV
LPY