Protein Info for DvMF_2074 in Desulfovibrio vulgaris Miyazaki F

Annotation: glycosyl transferase family 2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF13641: Glyco_tranf_2_3" amino acids 8 to 221 (214 residues), 30.2 bits, see alignment E=9.5e-11 PF00535: Glycos_transf_2" amino acids 9 to 167 (159 residues), 62.2 bits, see alignment E=1.2e-20 PF13506: Glyco_transf_21" amino acids 81 to 221 (141 residues), 30.9 bits, see alignment E=3.7e-11 PF13632: Glyco_trans_2_3" amino acids 89 to 220 (132 residues), 29.7 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_2074)

Predicted SEED Role

"glycosyl transferase, group 2 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ98 at UniProt or InterPro

Protein Sequence (374 amino acids)

>DvMF_2074 glycosyl transferase family 2 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRTVSVTLVTYTYDDHELVRGLLSSVTGWTAMPSAIVVIDDGSAQPFALDLPEEVTERLP
DIEVVRVPENRGNTHARALGAARATTRFILSVDADIRFPAHWLAVCLPAAARPGVGMAGT
AIRPRTGDDLLSRYLELTYTLNRGAAGSVPFLPGGAWLARRDAFEAVGGFSGYQERYGQD
AYLSRRLRDNGYLLWAVDGVEAFEVRRIGRLQMVRRGWRWQGHHMKAALDEGRPLDEVLN
VVLYSMRERMLRSRAADPRLLYFDLLYALHALLDTVAHAARTMGQTPGQGGVQAGVQSGG
EGARAALRHSAAAFLKPWPQLCTALCADLAELGHAPLPTDLAAAPPFDLAAALSFAVGND
ELAAVCRGLGDVLG