Protein Info for DvMF_2060 in Desulfovibrio vulgaris Miyazaki F

Annotation: small multidrug resistance protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 6 to 95 (90 residues), 71 bits, see alignment E=4.9e-24

Best Hits

KEGG orthology group: K11743, spermidine export protein MdtJ (inferred from 100% identity to dvm:DvMF_2060)

Predicted SEED Role

"Spermidine export protein MdtJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMP7 at UniProt or InterPro

Protein Sequence (135 amino acids)

>DvMF_2060 small multidrug resistance protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSNIIPWLFLSCSIVLEVAGTVIMKASQAAWPVPGMAAMYLLLGLSYWCLARAVTRVPVG
VAYAVWEGAGLALITLAGALMGERLTPSRMAALAAIFCGVLMVHHGTRHDAPRHARDGVT
ASSGRPAQADRKVTP