Protein Info for DvMF_2027 in Desulfovibrio vulgaris Miyazaki F

Annotation: inositol monophosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF00459: Inositol_P" amino acids 57 to 297 (241 residues), 128.6 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: K03677, CysQ protein (inferred from 100% identity to dvm:DvMF_2027)

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DML4 at UniProt or InterPro

Protein Sequence (320 amino acids)

>DvMF_2027 inositol monophosphatase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MIDPAGKAEGSPAATSVARSSAASFPLRDLLPLVMEAGRAILHWCGGAAPRIRRKADDSP
VTEADEASQAVLAHGLARLRPDLPVLSEEGRIPPHAERAGWPRFLLVDPLDGTRGFLNGE
GDFAVCLALVEHGFPTAGILHFPALGVTWFGGRGCGAWRLEHDAPPEPVHAARTFPQRAT
VMQGRVRRTPRLDAFLAAHADICSAAFPGRPGAPAPVPLPSDTAAQDRLRAGLFPHRRMQ
AGGPLKFCLVAEGAAHVFPCMHPTWEWDTAPGQALLEGAGGMVTLLDGRPLAYNKPDLRN
ECILAVGPAVCAPNTCAADT