Protein Info for DvMF_2020 in Desulfovibrio vulgaris Miyazaki F

Annotation: hydroxymethylbutenyl pyrophosphate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00216: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase" amino acids 2 to 280 (279 residues), 254.3 bits, see alignment E=6.6e-80 PF02401: LYTB" amino acids 3 to 278 (276 residues), 256.7 bits, see alignment E=1.2e-80

Best Hits

Swiss-Prot: 100% identical to ISPH_DESVM: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (ispH) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K03527, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [EC: 1.17.1.2] (inferred from 100% identity to dvm:DvMF_2020)

Predicted SEED Role

"4-hydroxy-3-methylbut-2-enyl diphosphate reductase (EC 1.17.1.2)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.17.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMK7 at UniProt or InterPro

Protein Sequence (281 amino acids)

>DvMF_2020 hydroxymethylbutenyl pyrophosphate reductase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKIIRARTAGFCMGVSLALRKLDREVTENNAPIATLGPIIHNPQVMAHYEERGVRCLRDT
AQVVPGQRVVIRAHGIPVAEETALKATGASVVDATCPKVKRAQLGIAEERGRGGTLLLFG
EADHPEVRGLLSYAGEGAMVFGSLDELKGLPLRDDVAYFLAAQTTQDRAGFEDVVSWLRQ
RLGHDIPVLQTICDATRKRQQEAVDIARRVQAMVVVGGFDSGNTRRLADVARAQGVFTVH
VETVDQLPVDELRKKSVIGLTAGASTPKSLIDAVQRFLESL