Protein Info for DvMF_2001 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF112 transmembrane (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 43 to 69 (27 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 315 to 338 (24 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 385 to 406 (22 residues), see Phobius details amino acids 413 to 439 (27 residues), see Phobius details amino acids 471 to 491 (21 residues), see Phobius details PF01970: TctA" amino acids 18 to 435 (418 residues), 457.4 bits, see alignment E=2e-141

Best Hits

KEGG orthology group: K07793, putative tricarboxylic transport membrane protein (inferred from 100% identity to dvm:DvMF_2001)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ80 at UniProt or InterPro

Protein Sequence (514 amino acids)

>DvMF_2001 protein of unknown function DUF112 transmembrane (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MMEFIGPAIMHLFEPLNILLMVAGLTGGIIVGALPGLTATMGVALMVPATFAMDATSGLI
MLGAIYAGAIYGGSNSACLICTPGTPSSVATTFDGWPLCQAGRADIGLITSLLSSVFGGI
VGTVFLLFLAAPLARFALQFGGPENFWLCIFGLSTIAVMSSGNMVKGLLSGAMGLLVSTV
GIDPNVGVPRFTFGYYPLVQGVEVIPAMIGLFSFSQVLYLIGSYKPFIAEYRPAPGAFGH
VVRALVGRCKVNLMRSSIIGTLVGMLPGAGGEIASIISYNEAKRWDKNPERYGTGVIEGV
AASESANNAVIGGSLIPMLTLGIPGSAVAAVILGALLAKGIQPGFKVFTATGDLAYTFIM
SQFAVNLLMIPIGLLLARIMTKLLSIRLTFVAIAIVVLSVIGSYAIRNSMLDVWIVIIFG
FLGYFSGRVGLDTGAMALGIILGPMIEENLGKCVHLSRASGGSVINVFLESPIAILLIVL
TLLSLATPFLLDWKRKRRDCGCDTEQPKEESSHA