Protein Info for DvMF_1983 in Desulfovibrio vulgaris Miyazaki F

Annotation: Phosphoglycolate phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00702: Hydrolase" amino acids 3 to 222 (220 residues), 75 bits, see alignment E=2.2e-24 PF13419: HAD_2" amino acids 6 to 122 (117 residues), 50.6 bits, see alignment E=4.9e-17 amino acids 172 to 225 (54 residues), 24.2 bits, see alignment E=6.1e-09 PF12710: HAD" amino acids 6 to 125 (120 residues), 28 bits, see alignment E=5.5e-10 PF13242: Hydrolase_like" amino acids 184 to 240 (57 residues), 32.3 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to dvm:DvMF_1983)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ62 at UniProt or InterPro

Protein Sequence (257 amino acids)

>DvMF_1983 Phosphoglycolate phosphatase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPIRAIIFDLDGTLLDTLDDLADAANACLLAQGFSAHPVDAYRQFVGDGVETLFRRALPP
GIPTGDATEQAVAALVARMREEYGARWSAKSAPYPGIRELLAALAPAGLPLGVLSNKPHA
FTRLMVGSFFDGAGSGAGAVSTDSPASASSPASAGSPASGGAPVEDGPLGPFAMVAGARP
GVPRKPDPAAAIATARALGVDPAHAAFVGDSNVDMRTAHGAGMLAVGCLWGFRGEAELRE
SGASVLLAHPLELLDHI