Protein Info for DvMF_1959 in Desulfovibrio vulgaris Miyazaki F

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 148 to 173 (26 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 276 (194 residues), 49.2 bits, see alignment E=2.7e-17

Best Hits

Swiss-Prot: 51% identical to POTB_SALTY: Spermidine/putrescine transport system permease protein PotB (potB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11071, spermidine/putrescine transport system permease protein (inferred from 100% identity to dvm:DvMF_1959)

MetaCyc: 53% identical to spermidine preferential ABC transporter membrane subunit PotB (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ38 at UniProt or InterPro

Protein Sequence (322 amino acids)

>DvMF_1959 binding-protein-dependent transport systems inner membrane component (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTQRRPFRTASIAVVWLWLGLFALLPNLGLLLVTFLERGESDFVSLVFTWDNYARLADPV
FIRILGESLWLAAASTLVCLLIGYPFAYAVATARRGLRPWLLLLVVIPFWTNSLIRTYAL
IIILKSQGIASNVLMALGLVSEPVSFMYGEFAVFTGLTYTLLPFMILPLYASIEKLDKRL
LDAAKDLGASSLRAFWHVTLPLTLPGIVAGCMLVFLPSLGCFYIPEILGGAKSMLIGNFI
KNQFLVARDWPLGAAASTILTVLLVLMIIGYWLSSRRVALRERKGADTGAATAGRTPDAA
QTDGDDGMTPGAHGAQGARGRA