Protein Info for DvMF_1957 in Desulfovibrio vulgaris Miyazaki F

Annotation: extracellular solute-binding protein family 1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF02030: Lipoprotein_8" amino acids 35 to 122 (88 residues), 25.1 bits, see alignment E=1.9e-09 PF01547: SBP_bac_1" amino acids 47 to 294 (248 residues), 103 bits, see alignment E=8.2e-33 PF13531: SBP_bac_11" amino acids 52 to 293 (242 residues), 65.5 bits, see alignment E=1.6e-21 PF13416: SBP_bac_8" amino acids 53 to 319 (267 residues), 132 bits, see alignment E=9.4e-42 PF13343: SBP_bac_6" amino acids 88 to 324 (237 residues), 83.6 bits, see alignment E=3.9e-27

Best Hits

Swiss-Prot: 51% identical to POTD_ECOLI: Spermidine/putrescine-binding periplasmic protein (potD) from Escherichia coli (strain K12)

KEGG orthology group: K11069, spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to dvm:DvMF_1957)

MetaCyc: 51% identical to spermidine preferential ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ36 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DvMF_1957 extracellular solute-binding protein family 1 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRTKLHAARAALVMVGLALAVLAATLFAGPAVAAEEKVLHVYNWSEYVPQSVLDRFTKET
GIKVVYTTYESNEAMYAKVKLLKGVGYDVVVPSTYFISMMRDDGLLARIDKSKLKNFKNL
SPKVLNQPFDPGNEYSVPYMWGSAGLMVNRKVVDPASITSWNDLNRPEFAGKVILSDDQR
DSMGVALKALGYSVNSTNEAEIKAAYEWLKKLLPAVRVFDVTASKQAFISEEVAAGLIWN
GDAYIAASENENLVYVYPREGVPLWVDSLAIPVGAKHKDNAHKFIDFLLRPDVAKECVEE
YNYSTPNVGAQKILSPELAKSRITSPSDADLKNAEFTNSVGNALEIYEKYWEMLKTGS