Protein Info for DvMF_1949 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF6 transmembrane (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details PF00892: EamA" amino acids 9 to 136 (128 residues), 69.2 bits, see alignment E=2.3e-23 amino acids 151 to 287 (137 residues), 61.7 bits, see alignment E=4.9e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1949)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ28 at UniProt or InterPro

Protein Sequence (299 amino acids)

>DvMF_1949 protein of unknown function DUF6 transmembrane (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRPVDLLRLLLLAAIWGSSFLFMRLVAPALGPLLTAELRVLLAGLALFAWFRATGTDIGL
RANRSFFVIVGTVNSGVPFALFAYAALHIPAAYSAVLNATAPLFGVICAAVWLRERVTPA
RVVGLALGIAGVAVMVGVGPVQPTPQMLLAVGAGLAAPLCYGLAATYIKLHGAGIRPGAV
AAGSQLGAALTLLPALPLWPAPALHDPALLSPLVLACTATLALVCGAVAYLLYFRLVEDT
GPARALTVTLLIPVFGMGWGALFLGERITPAMAAGAACIVAGLVLLLDLRQLFRGRSVA