Protein Info for DvMF_1933 in Desulfovibrio vulgaris Miyazaki F

Annotation: PAS modulated sigma54 specific transcriptional regulator, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF00989: PAS" amino acids 17 to 104 (88 residues), 31.2 bits, see alignment E=9.7e-11 TIGR00229: PAS domain S-box protein" amino acids 17 to 69 (53 residues), 23.6 bits, see alignment 2.4e-09 PF08448: PAS_4" amino acids 18 to 71 (54 residues), 39.7 bits, see alignment 2.5e-13 PF13426: PAS_9" amino acids 22 to 117 (96 residues), 25.9 bits, see alignment E=4.9e-09 PF00158: Sigma54_activat" amino acids 156 to 322 (167 residues), 222.8 bits, see alignment E=1.1e-69 PF14532: Sigma54_activ_2" amino acids 157 to 327 (171 residues), 82 bits, see alignment E=2.5e-26 PF07728: AAA_5" amino acids 178 to 299 (122 residues), 28.3 bits, see alignment E=8.2e-10 PF01078: Mg_chelatase" amino acids 231 to 298 (68 residues), 23.6 bits, see alignment E=1.5e-08 PF02954: HTH_8" amino acids 425 to 460 (36 residues), 50.3 bits, see alignment 8.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1933)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ12 at UniProt or InterPro

Protein Sequence (474 amino acids)

>DvMF_1933 PAS modulated sigma54 specific transcriptional regulator, Fis family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPTTHDAIVNDAVTFLIFDHLPMGILYCDASYVIRFANKAYAELLGKRPHDIIGRNITEV
IPSSRAPEVMTTGQAEMGDLCSIPGPRADQKLVVNRIPVRDAAGALVGMISQAIFNDPSE
LKRLSNKIEQLGHKLSQYKRRMAATLHAQYSLASLKGESASMHQIKDRLRSYARMDAPVL
VLGATGTGKELAAHALHAESTRAAGPLVSINCAAIPKDLFESELFGYVRGAFSGAHHSGK
MGQIELADGGTLFLDEIGDMPLQAQAKLLRVLESRTICRVGAVTAEPVDFRLIAATNRNI
KDMVQAGTFREDLYYRINTFIIEIPSLRDRKEDILPLAHHFLARMGHEGVTFTPAAVSAL
QSFEWPGNIRQLHNAILHAATMREGSAIDVCALPPEIRPVHTSPVAPCPLPQDRSDLAGI
LAHNEAALIENALREQGGNVTRAASALGVSRATLYEKMKKHGVHAVRSRDRQGN