Protein Info for DvMF_1916 in Desulfovibrio vulgaris Miyazaki F

Annotation: zinc/iron permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details PF02535: Zip" amino acids 120 to 265 (146 residues), 64 bits, see alignment E=7.4e-22

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 100% identity to dvm:DvMF_1916)

Predicted SEED Role

"Metal transporter, ZIP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPZ5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>DvMF_1916 zinc/iron permease (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MYTAFTELSPVMQAFLAGLFTWGVTALGAALVFLTKSFSRKALDVMLGFAAGVMIAASFW
SLLAPALEMSEHLGRWSFVPAAVGFVLGALFLRLVDMVLPHLHLHNPIEHAEGLPSTWQR
STLLVTAITLHNIPEGLAVGVAFGAVAADLPSASLAGAMALALGIGIQNFPEGTAVSVPL
RREGFSRMKAFLFGQASGMVEPIAAVIGAAAVLWAQPLLPYALAFAAGAMIFVVVEEVIP
ESQGSGYGDLATMGVIAGFTLMMTLDVALG