Protein Info for DvMF_1903 in Desulfovibrio vulgaris Miyazaki F

Annotation: Haloacid dehalogenase domain protein hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF00702: Hydrolase" amino acids 5 to 179 (175 residues), 73 bits, see alignment E=6.5e-24 PF13419: HAD_2" amino acids 6 to 180 (175 residues), 50.6 bits, see alignment E=3.6e-17 PF13242: Hydrolase_like" amino acids 147 to 180 (34 residues), 26.2 bits, see alignment 9.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1903)

Predicted SEED Role

"hydrolase, haloacid dehalogenase-like family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMK2 at UniProt or InterPro

Protein Sequence (213 amino acids)

>DvMF_1903 Haloacid dehalogenase domain protein hydrolase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPLSCIVFDCDGVILESVNVKTEAFARVAEPFGADARDRLVAYHMEHGGVSRYKKFEWLF
TEVLGREITSDEMDELGRRYADYAFEGVLNAPMVPGAHDVITAWHGRVPMYVCSGAPHEE
LVHILTERGLARYFEAIYGSPPGKTDVLRRAVEKAAVPPAEVVMIGDAKTDMTAAEAVGT
LFYGRGEAFAATPHPWGHDLTGLNAWLDGVAKA