Protein Info for DvMF_1875 in Desulfovibrio vulgaris Miyazaki F

Annotation: multi-sensor hybrid histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details PF00512: HisKA" amino acids 242 to 306 (65 residues), 74.7 bits, see alignment E=7.1e-25 PF02518: HATPase_c" amino acids 477 to 553 (77 residues), 71.3 bits, see alignment E=1.4e-23 PF00072: Response_reg" amino acids 579 to 693 (115 residues), 87 bits, see alignment E=1.5e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1875)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMH5 at UniProt or InterPro

Protein Sequence (705 amino acids)

>DvMF_1875 multi-sensor hybrid histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MAVTLFFLSRHGVHVHNPVLLFVVAIVLAAYLGGHASGLASVGLSLVYVLLTWSTGFATF
VYSEASVSRLVVFLLTMPVVSLLVSYLQTRNERMLERLEAKSERLRESEARLRRAELVAG
IGNWEADLRTGVLVTSEGARRIYGIPDHCDSFEVVKAIPLPEYRPALDAALHELVTRGVE
YVIEFRIRRPSDGGVADIQSRAKYDAERHRVYGTIKDITARKRAERELIEANRQAKSASE
TKSLFLANMSHEIRTPLNGILGALQLLKADLADPEQAGYANLAIRSSQRLAHLLTDLLDL
SRVEAGRMPVASEPFDLARLGEAVRELFQFELGTRGLALDVQLAPGLPQTVLGDEGKTRQ
ILFNLVGNALKFTERGGVRLSLSPLRGLPGLPDRPDQPDRPEQLDRSHPQPFRSGEAGGA
GDSVTAAGGNGAGSNGAGGNGAGRQGIPGGPDGSDRRDGADRPGALDETEATAGEVAGVL
FMVEDTGKGIPDALLRTIFDPFTQADNSYVRRHQGAGLGLSIVRRLVTLLGGTICVDSEE
GRGTVFCVALPFRTAERCELPPEVADCPPPPPDGAPVRVLLAEDDATTRLVGQRLLQKAG
YSVTLAVDGDDALARLAAEEVDVVLMDIHMPNTDGITAASTIRTSPRFADKCNVPILAVT
AAAMAGDRERFLAAGLDGYVAKPFDMADLVEEIECARRKRQVCYR