Protein Info for DvMF_1867 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF162 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02589: LUD_dom
  • amino acids 11 to 206 (196 residues), 121.9 bits, E=1.4e-39

Best Hits

KEGG orthology group: K00782, hypothetical protein (inferred from 100% identity to dvm:DvMF_1867)

MetaCyc: 73% identical to quinone-dependent L-lactate dehydrogenase small subunit (Desulfovibrio vulgaris)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, hypothetical protein subunit YkgG" in subsystem Lactate utilization

MetaCyc Pathways

• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (7/8 steps found)
• methylglyoxal degradation V (1/3 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

See B8DMG7 at UniProt or InterPro

Protein Sequence (209 amino acids)

>DvMF_1867 protein of unknown function DUF162 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSATNDLARLMREKAEAVGATVVELKDLKEAFAYALDVCDKKEACQLLVSGCEEKLSDKA
EALCETKQEKVVAAPNLSEDEYAAFSALCAERGVKCIREGLRGHLAGIDIGVAHADMAIA
ETGTCVIDSTSEELRLSSMISEIHMAILPKSRIKATAFDAEREVNALINTGTPRYTAFIT
GPSRTADIERVLAIGVHGPLELHILMLED