Protein Info for DvMF_1790 in Desulfovibrio vulgaris Miyazaki F

Annotation: CDP-diacylglycerol/serine O-phosphatidyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 14 to 171 (158 residues), 66.9 bits, see alignment E=1.4e-22 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 21 to 183 (163 residues), 128.9 bits, see alignment E=9.1e-42

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 100% identity to dvm:DvMF_1790)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM90 at UniProt or InterPro

Protein Sequence (249 amino acids)

>DvMF_1790 CDP-diacylglycerol/serine O-phosphatidyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MEQPARPIHKGVYILPNLFTTASLFAGFLGMLWAVSGRYEDCAMAILFSALMDGLDGKVA
RLTNTASEFGVQYDSLCDLVAFGVAPGFMMYQWQLHQYGRLGIAAAFLFAVCGALRLARF
NISTATTSKKFFIGLPIPAAGCAVATLVLFSPYVPEQFAGFFPRFCLALAFVLAFLMVSR
VRYASFKEYGLIKAHPFSSMVTAILLFVLVSSEPKLLGFLVFAGYLISGPVYTFVIIPRR
NHKLLRNLS