Protein Info for DvMF_1788 in Desulfovibrio vulgaris Miyazaki F

Annotation: SNARE associated Golgi protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 73 to 97 (25 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 227 to 227 (1 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details PF09335: SNARE_assoc" amino acids 207 to 259 (53 residues), 35.5 bits, see alignment 6.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1788)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM88 at UniProt or InterPro

Protein Sequence (314 amino acids)

>DvMF_1788 SNARE associated Golgi protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTRRIPLPACGPTSRPGILWTLAALLMAALVLLAPTTLAALSALTGHFPTLGPEDGLTLR
DRLLDLHARHPVVSVAAYMAGYVLMTACSIPGAVFLTLTGGAVFGFGVALAAVSAASTAG
ACLAFLSARHLLRATVRRLWPGQLARIDAAMAQGGGSPGGPTQAGTQPPSPFPDSSDHAS
AVHAAAGQASPARPPSGVPGSGLISPGALCLLGLRCVPVMPYWLVNLLFGVTAMRLSTFA
TVSLLGMVPLNALYVHAGAELGRIRHLGDIISLRAGLALCLLAVAPLLLRRVARTPQARP
CTGTHPASATDPPR