Protein Info for DvMF_1784 in Desulfovibrio vulgaris Miyazaki F

Annotation: membrane-bound metal-dependent hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details PF04307: YdjM" amino acids 1 to 183 (183 residues), 111.8 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K09151, hypothetical protein (inferred from 100% identity to dvm:DvMF_1784)

Predicted SEED Role

"hydrolase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM85 at UniProt or InterPro

Protein Sequence (365 amino acids)

>DvMF_1784 membrane-bound metal-dependent hydrolase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDPVTHLASGALVAMALPDTRRSRWFMPFALTCAVLPDVDVFFGSTPLDYLTLHRGITHS
FAGGAVMALLTALLFLPLLRRAPRDFMGSGGVHTWGYARHALAAYGLILLHIFLDCITTY
GTQVFLPFSDYRVALPAVFIIDPVMTLVMLACIVAAMGRAHRRTFAALGLAWTVLWPGAS
LAVQQHVQSGLVAKLAAQPVPPVSVAVIPEVLAPFNWKVVVDDGRRYGMARYQLLNPDAP
LALELFEKADPVLYRRLSEGEELFRVYGRFAMFMTQETRQENGASVIAYRDLRFASTVPF
MRMLRGEGVPFQLWARLSTDGRLEGFRFVQGRAAGGSDAAGAAGGTGGTGGTGGTGGGDW
VPVAR